Beta-defensin 1, pig TFA is an antimicrobial peptide found primarily in tongue mucosa of pig. Beta-defensin 1, pig TFA is active against bacteria such as Escherichia coli, Salmonella typhimurium, Listeria monocytogenes, Staphylococcus aureus, Bordetella pertussis and Candida albicans^[1][2].

Bacterial^[1]

Expression of beta-defensin (pBD-1) mRNA increased from the proximal to the distal part of the intestine whereas pBD-2 expression decreased. The main gene expression sites for pBD-2 are kidney and liver, whereas pBD-1 is mainly expressed in tongue^[1].
An eight-fold increase in pBD-1 mRNA expression is observed upon S. typhimurium infection in the porcine intestinal cell line IPEC J2^[1].
Porcine beta-defensin 1 (pBD-1) also has immunomodulatory activity in porcine peripheral blood mononuclear cells and lymph node cells^[3].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Resistance against respiratory infection with B. pertussis in older piglets is associated with the presence of Porcine beta-defensin 1 (pBD-1) in the upper respiratory tract. Furthermore, treatment with pBD-1 conferred complete protection of newborn piglets from intrapulmonary infection with B. pertussis^[3].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

7524.92

C₃₂₃H₅₃₅N₉₂F₃O₉₂S₉

Met-Arg-Ala-Leu-Cys-Leu-Leu-Leu-Leu-Thr-Val-Cys-Leu-Leu-Ser-Ser-Gln-Leu-Ala-Ala-Gly-Ile-Asn-Leu-Leu-Thr-Gly-Leu-Gly-Gln-Arg-Ser-Asp-His-Tyr-Ile-Cys-Ala-Lys-Lys-Gly-Gly-Thr-Cys-Asn-Phe-Ser-Pro-Cys-Pro-Leu-Phe-Asn-Arg-Ile-Glu-Gly-Thr-Cys-Tyr-Ser-Gly-Lys-Ala-Lys-Cys-Cys-Ile-Arg

MRALCLLLLTVCLLSSQLAAGINLLTGLGQRSDHYICAKKGGTCNFSPCPLFNRIEGTCYSGKAKCCIR

猪 β-防御素1 三氟乙酸盐

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Edwin J A Veldhuizen , et al. Expression of Beta-Defensins pBD-1 and pBD-2 Along the Small Intestinal Tract of the Pig: Lack of Upregulation in Vivo Upon Salmonella Typhimurium Infection. Mol Immunol. 2007 Jan;44(4):276-83.

  [2]. D R Pruthviraj, et al. Identification of a Novel Single Nucleotide Polymorphism in Porcine Beta-Defensin-1 Gene. Asian-Australas J Anim Sci. 2016 Mar;29(3):315-20.

  [3]. Shokrollah Elahi, et al. The Host Defense Peptide Beta-Defensin 1 Confers Protection Against Bordetella Pertussis in Newborn Piglets. Infect Immun. 2006 Apr;74(4):2338-52.

Beta-defensin 1, pig is an antimicrobial peptide found primarily in tongue mucosa of pig. Beta-defensin 1, pig is active against bacteria such as Escherichia coli, Salmonella typhimurium, Listeria monocytogenes, Staphylococcus aureus, Bordetella pertussis and Candida albicans^[1][2].

Bacterial^[1]

Expression of beta-defensin (pBD-1) mRNA increased from the proximal to the distal part of the intestine whereas pBD-2 expression decreased. The main gene expression sites for pBD-2 are kidney and liver, whereas pBD-1 is mainly expressed in tongue^[1].
An eight-fold increase in pBD-1 mRNA expression is observed upon S. typhimurium infection in the porcine intestinal cell line IPEC J2^[1].
Porcine beta-defensin 1 (pBD-1) also has immunomodulatory activity in porcine peripheral blood mononuclear cells and lymph node cells^[3].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Resistance against respiratory infection with B. pertussis in older piglets is associated with the presence of Porcine beta-defensin 1 (pBD-1) in the upper respiratory tract. Furthermore, treatment with pBD-1 conferred complete protection of newborn piglets from intrapulmonary infection with B. pertussis^[3].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

7410.90

C₃₂₁H₅₃₄N₉₂O₉₀S₉

Met-Arg-Ala-Leu-Cys-Leu-Leu-Leu-Leu-Thr-Val-Cys-Leu-Leu-Ser-Ser-Gln-Leu-Ala-Ala-Gly-Ile-Asn-Leu-Leu-Thr-Gly-Leu-Gly-Gln-Arg-Ser-Asp-His-Tyr-Ile-Cys-Ala-Lys-Lys-Gly-Gly-Thr-Cys-Asn-Phe-Ser-Pro-Cys-Pro-Leu-Phe-Asn-Arg-Ile-Glu-Gly-Thr-Cys-Tyr-Ser-Gly-Lys-Ala-Lys-Cys-Cys-Ile-Arg

MRALCLLLLTVCLLSSQLAAGINLLTGLGQRSDHYICAKKGGTCNFSPCPLFNRIEGTCYSGKAKCCIR

猪 β-防御素1

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Edwin J A Veldhuizen , et al. Expression of Beta-Defensins pBD-1 and pBD-2 Along the Small Intestinal Tract of the Pig: Lack of Upregulation in Vivo Upon Salmonella Typhimurium Infection. Mol Immunol. 2007 Jan;44(4):276-83.

  [2]. D R Pruthviraj, et al. Identification of a Novel Single Nucleotide Polymorphism in Porcine Beta-Defensin-1 Gene. Asian-Australas J Anim Sci. 2016 Mar;29(3):315-20.

  [3]. Shokrollah Elahi, et al. The Host Defense Peptide Beta-Defensin 1 Confers Protection Against Bordetella Pertussis in Newborn Piglets. Infect Immun. 2006 Apr;74(4):2338-52.