Super-TDU TFA is a specific YAP antagonist targeting YAP-TEADs interaction. Super-TDU TFA suppresses tumor growth in gastric cancer mouse model^[1].

Super-TDU TFA downregulates expression of YAP-TEADs target genes CTGF, CYR61, and CDX2. Super-TDU TFA inhibits cell viability and colony formation of GC cell lines MGC-803, BGC-823, and HGC27^[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Super-TDU TFA (intravenous Injection; 50 μg/kg or 500 μg/kg; per day) markedly decreases the sizes, weights of tumors, and YAP target genes in a dose-dependent manner in mice^[1].
Super-TDU TFA (Intravenous Injection; 250 μg/kg 500 μg/kg) has the t_1/2α of 0.78 hours and 0.82 hours; the C_max of 6.12 ng/mL and 13.3 ng/mL; the CL of 7.41 ml/min/kg and 7.72 ml/min/kg for 250 μg/kg and 500 μg/kg in mice, respectively^[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

5393.96

C₂₃₉H₃₇₁N₆₆O₇₁S

SVDDHFAKSLGDTWLQIGGSGNPKTANVPQTVPMRLRKLPDSFFKPPE

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Jiao S, et al. A peptide mimicking VGLL4 function acts as a YAP antagonist therapy against gastric cancer. Cancer Cell. 2014 Feb 10;25(2):166-80.